No secondary metabolite regions were found in these records:
c00001_HRGM_G.. (original name was: HRGM_Genome_1355_1) (Genus species)
c00002_HRGM_G.. (original name was: HRGM_Genome_1355_2) (Genus species)
c00003_HRGM_G.. (original name was: HRGM_Genome_1355_3) (Genus species)
c00004_HRGM_G.. (original name was: HRGM_Genome_1355_4) (Genus species)
c00005_HRGM_G.. (original name was: HRGM_Genome_1355_5) (Genus species)
c00006_HRGM_G.. (original name was: HRGM_Genome_1355_6) (Genus species)
c00007_HRGM_G.. (original name was: HRGM_Genome_1355_7) (Genus species)
c00008_HRGM_G.. (original name was: HRGM_Genome_1355_8) (Genus species)
c00009_HRGM_G.. (original name was: HRGM_Genome_1355_9) (Genus species)
c00010_HRGM_G.. (original name was: HRGM_Genome_1355_10) (Genus species)
c00011_HRGM_G.. (original name was: HRGM_Genome_1355_11) (Genus species)
c00012_HRGM_G.. (original name was: HRGM_Genome_1355_12) (Genus species)
c00013_HRGM_G.. (original name was: HRGM_Genome_1355_13) (Genus species)
c00015_HRGM_G.. (original name was: HRGM_Genome_1355_15) (Genus species)
c00016_HRGM_G.. (original name was: HRGM_Genome_1355_16) (Genus species)
c00017_HRGM_G.. (original name was: HRGM_Genome_1355_17) (Genus species)
c00018_HRGM_G.. (original name was: HRGM_Genome_1355_18) (Genus species)
c00019_HRGM_G.. (original name was: HRGM_Genome_1355_19) (Genus species)
c00021_HRGM_G.. (original name was: HRGM_Genome_1355_21) (Genus species)
c00023_HRGM_G.. (original name was: HRGM_Genome_1355_23) (Genus species)
c00024_HRGM_G.. (original name was: HRGM_Genome_1355_24) (Genus species)
c00025_HRGM_G.. (original name was: HRGM_Genome_1355_25) (Genus species)
c00026_HRGM_G.. (original name was: HRGM_Genome_1355_26) (Genus species)
c00027_HRGM_G.. (original name was: HRGM_Genome_1355_27) (Genus species)
c00028_HRGM_G.. (original name was: HRGM_Genome_1355_28) (Genus species)
c00029_HRGM_G.. (original name was: HRGM_Genome_1355_29) (Genus species)
c00030_HRGM_G.. (original name was: HRGM_Genome_1355_30) (Genus species)
c00031_HRGM_G.. (original name was: HRGM_Genome_1355_31) (Genus species)
c00032_HRGM_G.. (original name was: HRGM_Genome_1355_32) (Genus species)
c00033_HRGM_G.. (original name was: HRGM_Genome_1355_33) (Genus species)
c00034_HRGM_G.. (original name was: HRGM_Genome_1355_34) (Genus species)
c00035_HRGM_G.. (original name was: HRGM_Genome_1355_35) (Genus species)
c00036_HRGM_G.. (original name was: HRGM_Genome_1355_36) (Genus species)
c00037_HRGM_G.. (original name was: HRGM_Genome_1355_37) (Genus species)
c00038_HRGM_G.. (original name was: HRGM_Genome_1355_38) (Genus species)
c00039_HRGM_G.. (original name was: HRGM_Genome_1355_39) (Genus species)
c00040_HRGM_G.. (original name was: HRGM_Genome_1355_40) (Genus species)
c00042_HRGM_G.. (original name was: HRGM_Genome_1355_42) (Genus species)
c00043_HRGM_G.. (original name was: HRGM_Genome_1355_43) (Genus species)
c00044_HRGM_G.. (original name was: HRGM_Genome_1355_44) (Genus species)
c00045_HRGM_G.. (original name was: HRGM_Genome_1355_45) (Genus species)
c00046_HRGM_G.. (original name was: HRGM_Genome_1355_46) (Genus species)
c00047_HRGM_G.. (original name was: HRGM_Genome_1355_47) (Genus species)
c00048_HRGM_G.. (original name was: HRGM_Genome_1355_48) (Genus species)
c00049_HRGM_G.. (original name was: HRGM_Genome_1355_49) (Genus species)
c00050_HRGM_G.. (original name was: HRGM_Genome_1355_50) (Genus species)
c00051_HRGM_G.. (original name was: HRGM_Genome_1355_51) (Genus species)
c00052_HRGM_G.. (original name was: HRGM_Genome_1355_52) (Genus species)
c00053_HRGM_G.. (original name was: HRGM_Genome_1355_53) (Genus species)
c00054_HRGM_G.. (original name was: HRGM_Genome_1355_54) (Genus species)
c00055_HRGM_G.. (original name was: HRGM_Genome_1355_55) (Genus species)
c00056_HRGM_G.. (original name was: HRGM_Genome_1355_56) (Genus species)
c00057_HRGM_G.. (original name was: HRGM_Genome_1355_57) (Genus species)
c00058_HRGM_G.. (original name was: HRGM_Genome_1355_58) (Genus species)
c00059_HRGM_G.. (original name was: HRGM_Genome_1355_59) (Genus species)
c00060_HRGM_G.. (original name was: HRGM_Genome_1355_60) (Genus species)
c00061_HRGM_G.. (original name was: HRGM_Genome_1355_61) (Genus species)
c00062_HRGM_G.. (original name was: HRGM_Genome_1355_62) (Genus species)
c00063_HRGM_G.. (original name was: HRGM_Genome_1355_63) (Genus species)
c00064_HRGM_G.. (original name was: HRGM_Genome_1355_64) (Genus species)
c00065_HRGM_G.. (original name was: HRGM_Genome_1355_65) (Genus species)
c00066_HRGM_G.. (original name was: HRGM_Genome_1355_66) (Genus species)
c00067_HRGM_G.. (original name was: HRGM_Genome_1355_67) (Genus species)
c00068_HRGM_G.. (original name was: HRGM_Genome_1355_68) (Genus species)
c00069_HRGM_G.. (original name was: HRGM_Genome_1355_69) (Genus species)
Compact view
c00014_HRGM_G.. - Region 1 - sactipeptide
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key. More detailed help is available here.
sactipeptide: (subtilosin or thuricin or TIGR04404 or TIGR03973)
Legend:
core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
reset view
zoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
ClusterBlast
KnownClusterBlast
SubClusterBlast
Sactipeptides
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region. Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region. Click on an accession to open that entry in the MiBIG database.
No matches found.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region.
No matches found.
Sactipeptide predictions
Lists the possible core peptides for each biosynthetic enzyme, including the predicted class. Each core peptide shows the leader and core peptide sequences, separated by a dash.
Sactipeptides - No core peptides found.
Sactipeptides
Core peptide predictions
Lists the possible core peptides in the region. Each core peptide lists its RODEO score and predicted core sequence.
No core peptides found.
c00020_HRGM_G.. - Region 1 - NRPS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key. More detailed help is available here.
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
Legend:
core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
reset view
zoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details. A glossary is available here.
Selected features only
Show module domains
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region. Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region. Click on an accession to open that entry in the MiBIG database.
No matches found.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region.
No matches found.
c00022_HRGM_G.. - Region 1 - NRPS
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key. More detailed help is available here.
NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))
Legend:
core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
reset view
zoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
NRPS/PKS domains
ClusterBlast
KnownClusterBlast
SubClusterBlast
Detailed domain annotation
Shows NRPS- and PKS-related domains for each feature that contains them. Click on each domain for more information about the domain's location, consensus monomer prediction, and other details. A glossary is available here.
Selected features only
Show module domains
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region. Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region. Click on an accession to open that entry in the MiBIG database.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region.
No matches found.
NRPS/PKS products
NRPS/PKS monomers
Predicted core structure(s)
Shows estimated product structure and polymer for each candidate cluster in the region. To show the product, click on the expander or the candidate cluster feature drawn in the overview.
For candidate cluster 1, location 26504 - 70262:
Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account
Shows the predicted monomers for each adynelation domain and acyltransferase within genes. Each gene prediction can be expanded to view detailed predictions of each domain. Each prediction can be expanded to view the predictions by tool (and, for some tools, further expanded for extra details).
Shows the layout of the region, marking coding sequences and areas of interest. Clicking a gene will select it and show any relevant details. Clicking an area feature (e.g. a candidate cluster) will select all coding sequences within that area. Double clicking an area feature will zoom to that area. Multiple genes and area features can be selected by clicking them while holding the Ctrl key. More detailed help is available here.
lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))
Legend:
core biosynthetic genes
additional biosynthetic genes
transport-related genes
regulatory genes
other genes
resistance
reset view
zoom to selection
Gene details
Shows details of the most recently selected gene, including names, products, location, and other annotations.
Select a gene to view the details available for it
Lanthipeptides
ClusterBlast
KnownClusterBlast
SubClusterBlast
Lanthipeptide predictions
Lists the possible core peptides for each biosynthetic enzyme, including the predicted class. Each core peptide shows the leader and core peptide sequences, separated by a dash.
Lanthipeptide(s) for HRGM_Genome_1355_CDS_03618 - Putative Class II
HRGM_Genome_1355_CDS_03619 leader / core peptide
MTEEFIGCIEEELKEIELFYEENGVEVEAYTLHNG
-
DhaLFDhbICC
Legend:
Dha: Didehydroalanine Dhb: Didehydrobutyrine
Similar gene clusters
Shows clusters from the antiSMASH database and other clusters of interest that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region. Click on an accession to open that entry in the antiSMASH database (if applicable).
Similar known gene clusters
Shows clusters from the MiBIG database that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region. Click on an accession to open that entry in the MiBIG database.
No matches found.
Similar subclusters
Shows sub-cluster units that are similar to the current region. Genes marked with the same colour are interrelated. White genes have no relationship. Click on reference genes to show details of similarities to genes within the current region.
No matches found.
Lanthipeptides
Core peptide predictions
Lists the possible core peptides in the region. Each core peptide lists the number of lanthionine bridges, possible molecular weights, and the scores for cleavage site prediction and RODEO.
reset view
zoom to selection