HRGM_Genome_1228 - 5 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

c00003_HRGM_G.. (original name was: HRGM_Genome_1228_3) (Genus species)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	bacteriocin	80,862	91,707

c00005_HRGM_G.. (original name was: HRGM_Genome_1228_5) (Genus species)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS	44,631	91,059	streptobactin	NRP	17%

c00012_HRGM_G.. (original name was: HRGM_Genome_1228_12) (Genus species)

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	bacteriocin	193,714	204,589

c00024_HRGM_G.. (original name was: HRGM_Genome_1228_24) (Genus species)

Region	Type	From	To	Most similar known cluster		Similarity
Region 24.1	arylpolyene	77,345	120,947	aryl polyenes	Other	44%

c00034_HRGM_G.. (original name was: HRGM_Genome_1228_34) (Genus species)

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	lanthipeptide	105,828	128,725

Region	Type	From	To	Most similar known cluster	Similarity
Region 3.1	bacteriocin	80,862	91,707
Region 5.1	NRPS	44,631	91,059	streptobactin	NRP	17%
Region 12.1	bacteriocin	193,714	204,589
Region 24.1	arylpolyene	77,345	120,947	aryl polyenes	Other	44%
Region 34.1	lanthipeptide	105,828	128,725

No secondary metabolite regions were found in these records:: c00001_HRGM_G.. (original name was: HRGM_Genome_1228_1) (Genus species); c00002_HRGM_G.. (original name was: HRGM_Genome_1228_2) (Genus species); c00004_HRGM_G.. (original name was: HRGM_Genome_1228_4) (Genus species); c00006_HRGM_G.. (original name was: HRGM_Genome_1228_6) (Genus species); c00007_HRGM_G.. (original name was: HRGM_Genome_1228_7) (Genus species); c00008_HRGM_G.. (original name was: HRGM_Genome_1228_8) (Genus species); c00009_HRGM_G.. (original name was: HRGM_Genome_1228_9) (Genus species); c00010_HRGM_G.. (original name was: HRGM_Genome_1228_10) (Genus species); c00011_HRGM_G.. (original name was: HRGM_Genome_1228_11) (Genus species); c00013_HRGM_G.. (original name was: HRGM_Genome_1228_13) (Genus species); c00014_HRGM_G.. (original name was: HRGM_Genome_1228_14) (Genus species); c00015_HRGM_G.. (original name was: HRGM_Genome_1228_15) (Genus species); c00016_HRGM_G.. (original name was: HRGM_Genome_1228_16) (Genus species); c00017_HRGM_G.. (original name was: HRGM_Genome_1228_17) (Genus species); c00018_HRGM_G.. (original name was: HRGM_Genome_1228_18) (Genus species); c00019_HRGM_G.. (original name was: HRGM_Genome_1228_19) (Genus species); c00020_HRGM_G.. (original name was: HRGM_Genome_1228_20) (Genus species); c00021_HRGM_G.. (original name was: HRGM_Genome_1228_21) (Genus species); c00022_HRGM_G.. (original name was: HRGM_Genome_1228_22) (Genus species); c00023_HRGM_G.. (original name was: HRGM_Genome_1228_23) (Genus species); c00025_HRGM_G.. (original name was: HRGM_Genome_1228_25) (Genus species); c00026_HRGM_G.. (original name was: HRGM_Genome_1228_26) (Genus species); c00027_HRGM_G.. (original name was: HRGM_Genome_1228_27) (Genus species); c00028_HRGM_G.. (original name was: HRGM_Genome_1228_28) (Genus species); c00029_HRGM_G.. (original name was: HRGM_Genome_1228_29) (Genus species); c00030_HRGM_G.. (original name was: HRGM_Genome_1228_30) (Genus species); c00031_HRGM_G.. (original name was: HRGM_Genome_1228_31) (Genus species); c00032_HRGM_G.. (original name was: HRGM_Genome_1228_32) (Genus species); c00033_HRGM_G.. (original name was: HRGM_Genome_1228_33) (Genus species); c00035_HRGM_G.. (original name was: HRGM_Genome_1228_35) (Genus species)

Compact view

c00003_HRGM_G.. - Region 1 - bacteriocin

Download region GenBank file

Location: 80,862 - 91,707 nt. (total: 10,846 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

ClusterBlast

KnownClusterBlast

SubClusterBlast

Similar gene clusters

Similar known gene clusters

No matches found.

Similar subclusters

No matches found.

c00005_HRGM_G.. - Region 1 - NRPS

Download region GenBank file

Location: 44,631 - 91,059 nt. (total: 46,429 nt) Show pHMM detection rules used

NRPS: (cds(Condensation and (AMP-binding or A-OX)) or (Condensation and AMP-binding))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

ClusterBlast

KnownClusterBlast

SubClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 44630 - 91059:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

HRGM_Genome_1228_CDS_00540

Search NORINE for peptide: strict or relaxed

AMP-binding (457..845): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

HRGM_Genome_1228_CDS_00543

Search NORINE for peptide: strict or relaxed

AMP-binding (39..444): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PMPgQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 90% (moderate)

c00012_HRGM_G.. - Region 1 - bacteriocin

Download region GenBank file

Location: 193,714 - 204,589 nt. (total: 10,876 nt) Show pHMM detection rules used

bacteriocin: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03603 or TIGR03604 or TIGR03651 or TIGR03678 or TIGR03693 or TIGR03798 or TIGR03601 or TIGR03602 or TIGR03795 or TIGR03793 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

ClusterBlast

KnownClusterBlast

SubClusterBlast

Similar gene clusters

Similar known gene clusters

No matches found.

Similar subclusters

No matches found.

c00024_HRGM_G.. - Region 1 - arylpolyene

Download region GenBank file

Location: 77,345 - 120,947 nt. (total: 43,603 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

ClusterBlast

KnownClusterBlast

SubClusterBlast

Similar gene clusters

Similar known gene clusters

Similar subclusters

No matches found.

c00034_HRGM_G.. - Region 1 - lanthipeptide

Download region GenBank file

Location: 105,828 - 128,725 nt. (total: 22,898 nt) Show pHMM detection rules used

lanthipeptide: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C) or cds(LANC_like and (Pkinase or DUF4135))) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

Lanthipeptides

ClusterBlast

KnownClusterBlast

SubClusterBlast

Lanthipeptide predictions

Lanthipeptide(s) for HRGM_Genome_1228_CDS_04001 - Putative Class II

HRGM_Genome_1228_CDS_04000 leader / core peptide: MDLNDDVVSGWLNGSDDVDGCANPAGSLFIYGA - AADhbEDhaALDhbDhaADhaDDhbLIDhbGGGDhbECDhbDhbDhbMDhaVVNHCLCC
allorf_108653_108874 leader / core peptide: MAPSMAPTVLERAACPLLTVSWCVRMRRSAGRLLPQLAGNRPESVGS - PRAGPLAPRMAPDhaDhaPHGWVHGVDhaCPG
allorf_115238_115378 leader / core peptide: VPAPAGHPMSLRLPSIRSRMNGA - RPRIPCRLRAAHAAHPRACRDhaAA
allorf_123523_123690 leader / core peptide: VVVRLDCDGWPGGWAVQGA - LQVRPCKLGRRIHAAHAPAQPIRPADhbDRFRARPPRN

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Similar gene clusters

Similar known gene clusters

No matches found.

Similar subclusters

No matches found.

Lanthipeptides

Core peptide predictions

HRGM_Genome_1228_CDS_04000 - Class II

Cleavage pHMM score: -6.70

RODEO score: 0

Monoisotopic mass: 3231.5 Da

Molecular weight: 3233.6 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3251.6 Da N = 1; 3269.6 Da N = 2; 3287.7 Da N = 3; 3305.7 Da N = 4; 3323.7 Da N = 5; 3341.7 Da N = 6; 3359.7 Da N = 7; 3377.8 Da N = 8

allorf_108653_108874 - Class II

Cleavage pHMM score: -5.70

RODEO score: 0

Monoisotopic mass: 2566.3 Da

Molecular weight: 2567.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2586.0 Da N = 1; 2604.0 Da N = 2

allorf_115238_115378 - Class II

Cleavage pHMM score: -1.60

RODEO score: 0

Monoisotopic mass: 2518.4 Da

Molecular weight: 2520.0 Da

Number of bridges: 1

allorf_123523_123690 - Class II

Cleavage pHMM score: -4.70

RODEO score: 0

Monoisotopic mass: 4104.3 Da

Molecular weight: 4106.8 Da

Number of bridges: 1